SENP2 antibody (70R-3981)

Rabbit polyclonal SENP2 antibody raised against the middle region of SENP2

Synonyms Polyclonal SENP2 antibody, Anti-SENP2 antibody, SENP 2, Sumo1/Sentrin/Smt3 Specific Peptidase 2 antibody, KIAA1331 antibody, SENP-2 antibody, SENP-2, SENP 2 antibody, DKFZp762A2316 antibody, SENP2, SMT3IP2 antibody, AXAM2 antibody
Specificity SENP2 antibody was raised against the middle region of SENP2
Cross Reactivity Human
Applications WB
Immunogen SENP2 antibody was raised using the middle region of SENP2 corresponding to a region with amino acids RICEILLQYLQDESKTKRNSDLNLLEWTHHSMKPHEIPQQLNGSDCGMFT
Assay Information SENP2 Blocking Peptide, catalog no. 33R-7961, is also available for use as a blocking control in assays to test for specificity of this SENP2 antibody


Western Blot analysis using SENP2 antibody (70R-3981)

SENP2 antibody (70R-3981) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 68 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SENP2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SUMO1 is a small ubiquitin-like protein that can be covalently conjugated to other proteins. SENP2 is one of a group of enzymes that process newly synthesized SUMO1 into the conjugatable form and catalyze the deconjugation of SUMO1-containing species.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using SENP2 antibody (70R-3981) | SENP2 antibody (70R-3981) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors