SENP2 Blocking Peptide (33R-7961)

A synthetic peptide for use as a blocking control in assays to test for specificity of SENP2 antibody, catalog no. 70R-3981

Synonyms SENP2 control peptide, SENP2 antibody Blocking Peptide, Anti-SENP2 Blocking Peptide, Sumo1/Sentrin/Smt3 Specific Peptidase 2 Blocking Peptide, AXAM2 Blocking Peptide, DKFZp762A2316 Blocking Peptide, KIAA1331 Blocking Peptide, SMT3IP2 Blocking Peptide, SENP2, SENP-2, SENP 2, SENP-2 Blocking Peptide, SENP 2 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues RICEILLQYLQDESKTKRNSDLNLLEWTHHSMKPHEIPQQLNGSDCGMFT
Molecular Weight 68 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SUMO1 is a small ubiquitin-like protein that can be covalently conjugated to other proteins. SENP2 is one of a group of enzymes that process newly synthesized SUMO1 into the conjugatable form and catalyze the deconjugation of SUMO1-containing species.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors