SENP2 Blocking Peptide (33R-7961)
A synthetic peptide for use as a blocking control in assays to test for specificity of SENP2 antibody, catalog no. 70R-3981
Overview
Overview
| Synonyms | SENP2 control peptide, SENP2 antibody Blocking Peptide, Anti-SENP2 Blocking Peptide, Sumo1/Sentrin/Smt3 Specific Peptidase 2 Blocking Peptide, AXAM2 Blocking Peptide, DKFZp762A2316 Blocking Peptide, KIAA1331 Blocking Peptide, SMT3IP2 Blocking Peptide, SENP2, SENP-2, SENP 2, SENP-2 Blocking Peptide, SENP 2 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | RICEILLQYLQDESKTKRNSDLNLLEWTHHSMKPHEIPQQLNGSDCGMFT |
|---|---|
| Molecular Weight | 68 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | SUMO1 is a small ubiquitin-like protein that can be covalently conjugated to other proteins. SENP2 is one of a group of enzymes that process newly synthesized SUMO1 into the conjugatable form and catalyze the deconjugation of SUMO1-containing species. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product