Septin 12 antibody (70R-5540)

Rabbit polyclonal Septin 12 antibody raised against the middle region of 40433

Synonyms Polyclonal Septin 12 antibody, Anti-Septin 12 antibody, Septin 12 antibody, FLJ25410 antibody, Septin -12, Septin -12 antibody, Septin 12, 41153 antibody, Septin 12
Specificity Septin 12 antibody was raised against the middle region of 40433
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen Septin 12 antibody was raised using the middle region of 40433 corresponding to a region with amino acids LQRLCRTVNVVPVIARADSLTMEEREAFRRRIQQNLRTHCIDVYPQMCFD
Assay Information Septin 12 Blocking Peptide, catalog no. 33R-5333, is also available for use as a blocking control in assays to test for specificity of this Septin 12 antibody


Western Blot analysis using Septin 12 antibody (70R-5540)

Septin 12 antibody (70R-5540) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 41 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of 41153 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Septins, such as SEPT12, are conserved GTP-binding proteins that function as dynamic, regulatable scaffolds for the recruitment of other proteins. They are involved in membrane dynamics, vesicle trafficking, apoptosis, and cytoskeleton remodeling, as well as infection, neurodegeneration, and neoplasia.Septins, such as SEPT12, are conserved GTP-binding proteins that function as dynamic, regulatable scaffolds for the recruitment of other proteins.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using Septin 12 antibody (70R-5540) | Septin 12 antibody (70R-5540) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors