Septin 2 Blocking Peptide (33R-6451)

A synthetic peptide for use as a blocking control in assays to test for specificity of SEPT2 antibody, catalog no. 70R-5632

Synonyms Septin 2 control peptide, Septin 2 antibody Blocking Peptide, Anti-Septin 2 Blocking Peptide, DIFF6 Blocking Peptide, KIAA0158 Blocking Peptide, NEDD5 Blocking Peptide, Pnutl3 Blocking Peptide, hNedd5 Blocking Peptide, 37500 Blocking Peptide, Septin 2, Septin -2, Septin 2, Septin -2 Blocking Peptide, Septin 2 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues MSKQQPTQFINPETPGYVGFANLPNQVHRKSVKKGFEFTLMVVGESGLGK
Molecular Weight 41 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SEPT2 is required for normal progress through mitosis. SEPT2 is involved in cytokinesis.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors