Septin 2 Blocking Peptide (33R-6451)
A synthetic peptide for use as a blocking control in assays to test for specificity of SEPT2 antibody, catalog no. 70R-5632
Overview
Overview
| Synonyms | Septin 2 control peptide, Septin 2 antibody Blocking Peptide, Anti-Septin 2 Blocking Peptide, DIFF6 Blocking Peptide, KIAA0158 Blocking Peptide, NEDD5 Blocking Peptide, Pnutl3 Blocking Peptide, hNedd5 Blocking Peptide, 37500 Blocking Peptide, Septin 2, Septin -2, Septin 2, Septin -2 Blocking Peptide, Septin 2 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | MSKQQPTQFINPETPGYVGFANLPNQVHRKSVKKGFEFTLMVVGESGLGK |
|---|---|
| Molecular Weight | 41 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | SEPT2 is required for normal progress through mitosis. SEPT2 is involved in cytokinesis. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product