Septin 6 antibody (70R-1950)

Rabbit polyclonal Septin 6 antibody raised against the N terminal of 40427

Synonyms Polyclonal Septin 6 antibody, Anti-Septin 6 antibody, Septin -6 antibody, 38961 antibody, RP5-876A24.2 antibody, Septin 6, KIAA0128 antibody, SEPT2 antibody, MGC20339 antibody, MGC16619 antibody, SEP2 antibody, Septin -6, Septin 6, Septin 6 antibody
Specificity Septin 6 antibody was raised against the N terminal of 40427
Cross Reactivity Human,Mouse
Applications WB
Immunogen Septin 6 antibody was raised using the N terminal of 40427 corresponding to a region with amino acids TGLGKSTLMDTLFNTKFEGEPATHTQPGVQLQSNTYDLQESNVRLKLTIV

Images

Western Blot analysis using Septin 6 antibody (70R-1950)

Septin 6 antibody (70R-1950) used at 0.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 12 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of 38961 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SEPT6 is a member of the septin family of GTPases. Members of this family are required for cytokinesis.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Septin 6 antibody (70R-1950) | Septin 6 antibody (70R-1950) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
OR
Shipping
View Our Distributors