Septin 9 antibody (70R-2210)

Rabbit polyclonal Septin 9 antibody raised against the C terminal of 40430

Synonyms Polyclonal Septin 9 antibody, Anti-Septin 9 antibody, Septin -9, SINT1 antibody, 40057 antibody, KIAA0991 antibody, Septin 9, MSF antibody, SeptD1 antibody, PNUTL4 antibody, Septin 9, Septin -9 antibody, MSF1 antibody, AF17q25 antibody, Septin 9 antibody, NAPB antibody
Specificity Septin 9 antibody was raised against the C terminal of 40430
Cross Reactivity Human
Applications WB
Immunogen Septin 9 antibody was raised using the C terminal of 40430 corresponding to a region with amino acids HCEFAYLRDLLIRTHMQNIKDITSSIHFEAYRVKRLNEGSSAMANGMEEK

Images

Western Blot analysis using Septin 9 antibody (70R-2210)

Septin 9 antibody (70R-2210) used at 0.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 37 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of 40057 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Septin-9 is a member of the septin family, which contains cytoplasmic cytoskeletal filament-forming proteins that have a conserved GTP-binding domain.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Septin 9 antibody (70R-2210) | Septin 9 antibody (70R-2210) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
OR
Shipping
View Our Distributors