Septin 9 Blocking Peptide (33R-9702)

A synthetic peptide for use as a blocking control in assays to test for specificity of SEPT9 antibody, catalog no. 70R-3525

Synonyms Septin 9 control peptide, Septin 9 antibody Blocking Peptide, Anti-Septin 9 Blocking Peptide, AF17q25 Blocking Peptide, KIAA0991 Blocking Peptide, MSF Blocking Peptide, MSF1 Blocking Peptide, NAPB Blocking Peptide, PNUTL4 Blocking Peptide, SINT1 Blocking Peptide, SeptD1 Blocking Peptide, 40057 Blocking Peptide, Septin 9, Septin -9, Septin 9, Septin -9 Blocking Peptide, Septin 9 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues VNEKFREMIPFAVVGSDHEYQVNGKRILGRKTKWGTIEVENTTHCEFAYL
Molecular Weight 46 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene is a member of the septin family involved in cytokinesis and cell cycle control. This gene is a candidate for the ovarian tumor suppressor gene. Mutations in this gene cause hereditary neuralgic amyotrophy, also known as neuritis with brachial predilection. A chromosomal translocation involving this gene on chromosome 17 and the MLL gene on chromosome 11 results in acute myelomonocytic leukemia. Multiple alternatively spliced transcript variants encoding different isoforms have been described.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors