Serotonin receptor 2B Blocking Peptide (33R-7748)

A synthetic peptide for use as a blocking control in assays to test for specificity of HTR2B antibody, catalog no. 70R-3768

Synonyms Serotonin receptor 2B control peptide, Serotonin receptor 2B antibody Blocking Peptide, Anti-Serotonin receptor 2B Blocking Peptide, 5-Hydroxytryptamine Blocking Peptide, 5-HT(2B) Blocking Peptide, 5-HT2B Blocking Peptide, HTR2B Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues QTESIPEEMKQIVEEQGNKLHWAALLILMVIIPTIGGNTLVILAVSLEKK
Molecular Weight 54 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Multiple receptor subtypes of serotonin neurotransmitters with multiple physiologic functions have been recognised. The 5-HT-2 receptors mediate many of the central and peripheral physiologic functions of serotonin. Cardiovascular effects include contraction of blood vessels and shape changes in platelets; central nervous system effects include neuronal sensitization to tactile stimuli and mediation of hallucinogenic effects of phenylisopropylamine hallucinogens.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors