Serotonin receptor 2B Blocking Peptide (33R-7748)
A synthetic peptide for use as a blocking control in assays to test for specificity of HTR2B antibody, catalog no. 70R-3768
Overview
Overview
| Synonyms | Serotonin receptor 2B control peptide, Serotonin receptor 2B antibody Blocking Peptide, Anti-Serotonin receptor 2B Blocking Peptide, 5-Hydroxytryptamine Blocking Peptide, 5-HT(2B) Blocking Peptide, 5-HT2B Blocking Peptide, HTR2B Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | QTESIPEEMKQIVEEQGNKLHWAALLILMVIIPTIGGNTLVILAVSLEKK |
|---|---|
| Molecular Weight | 54 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | Multiple receptor subtypes of serotonin neurotransmitters with multiple physiologic functions have been recognised. The 5-HT-2 receptors mediate many of the central and peripheral physiologic functions of serotonin. Cardiovascular effects include contraction of blood vessels and shape changes in platelets; central nervous system effects include neuronal sensitization to tactile stimuli and mediation of hallucinogenic effects of phenylisopropylamine hallucinogens. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product