Serotonin receptor 3B antibody (70R-5080)

Rabbit polyclonal Serotonin receptor 3B antibody

Synonyms Polyclonal Serotonin receptor 3B antibody , Anti-Serotonin receptor 3B antibody, HTR3B antibody, 5-Hydroxytryptamine antibody
Cross Reactivity Human
Applications IHC, WB
Immunogen Serotonin receptor 3B antibody was raised using a synthetic peptide corresponding to a region with amino acids PLWACILVAAGILATDTHHPQDSALYHLSKQLLQKYHKEVRPVYNWTKAT
Assay Information Serotonin receptor 3B Blocking Peptide , catalog no. 33R-7215, is also available for use as a blocking control in assays to test for specificity of this Serotonin receptor 3B antibody


Immunohistochemical staining using Serotonin receptor 3B antibody (70R-5080)

Serotonin receptor 3B antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Spleen cells (arrows) in Human Spleen. Magnification is at 400X


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 49 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HTR3B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The product of HTR3B belongs to the ligand-gated ion channel receptor superfamily. HTR3B encodes subunit B of the type 3 receptor for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor causes fast, depolarizing responses in neurons after activation.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using Serotonin receptor 3B antibody  (70R-5080) | Serotonin receptor 3B antibody  was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Spleen cells (arrows) in Human Spleen. Magnification is at 400X
  • Western Blot analysis using Serotonin receptor 3B antibody  (70R-5080) | Serotonin receptor 3B antibody (70R-5080) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors