SERPINA5 antibody (70R-5417)

Rabbit polyclonal SERPINA5 antibody

Synonyms Polyclonal SERPINA5 antibody, Anti-SERPINA5 antibody, PCI antibody, Alpha 1 Antiproteinase antibody, SERPINA 5 antibody, SERPINA-5, SERPINA-5 antibody, PROCI antibody, SERPINA 5, PLANH3 antibody, Serpin Peptidase Inhibitor Clade A Member 5 antibody, SERPINA5, PAI3 antibody
Cross Reactivity Human
Applications WB
Immunogen SERPINA5 antibody was raised using a synthetic peptide corresponding to a region with amino acids VFTSHADLSGISNHSNIQVSEMVHKAVVEVDESGTRAAAATGTIFTFRSA
Assay Information SERPINA5 Blocking Peptide, catalog no. 33R-9544, is also available for use as a blocking control in assays to test for specificity of this SERPINA5 antibody


Western Blot analysis using SERPINA5 antibody (70R-5417)

SERPINA5 antibody (70R-5417) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 45 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SERPINA5 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SERPINA5 belongs to the serpin family. It Inhibits activated protein C as well as plasminogen activators.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using SERPINA5 antibody (70R-5417) | SERPINA5 antibody (70R-5417) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors