SLC35E2 Blocking Peptide (33R-1007)

A synthetic peptide for use as a blocking control in assays to test for specificity of Serpinc1 antibody, catalog no. 70R-8503

Synonyms Serpinc1 control peptide, Serpinc1 antibody Blocking Peptide, Anti-Serpinc1 Blocking Peptide, serine, or cysteine peptidase inhibitor, clade C, antithrombin, member 1 Blocking Peptide, AI114908 Blocking Peptide, ATIII Blocking Peptide, At-3 Blocking Peptide, At3 Blocking Peptide, Serpinc1, Serpinc-1, Serpinc 1, Serpinc-1 Blocking Peptide, Serpinc 1 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues AAASTSVVITGRSLNPNRVTFKANRPFLVLIREVALNTIIFMGRVANPCV
Molecular Weight 52 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Serpinc1 is the most important serine protease inhibitor in plasma that regulates the blood coagulation cascade. AT-III inhibits thrombin as well as factors IXa, Xa and XIa. Its inhibitory activity is greatly enhanced in the presence of heparin.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €113.70
Size: 100 ug
OR
Shipping
View Our Distributors