Serpinc1 Blocking Peptide (33R-1008)
A synthetic peptide for use as a blocking control in assays to test for specificity of Serpinc1 antibody, catalog no. 70R-8503
Overview
Overview
| Synonyms | Serpinc1 control peptide, Serpinc1 antibody Blocking Peptide, Anti-Serpinc1 Blocking Peptide, serine, or cysteine peptidase inhibitor, clade C, antithrombin, member 1 Blocking Peptide, AI114908 Blocking Peptide, ATIII Blocking Peptide, At-3 Blocking Peptide, At3 Blocking Peptide, Serpinc1, Serpinc-1, Serpinc 1, Serpinc-1 Blocking Peptide, Serpinc 1 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | AAASTSVVITGRSLNPNRVTFKANRPFLVLIREVALNTIIFMGRVANPCV |
|---|---|
| Molecular Weight | 52 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | Serpinc1 is the most important serine protease inhibitor in plasma that regulates the blood coagulation cascade. AT-III inhibits thrombin as well as factors IXa, Xa and XIa. Its inhibitory activity is greatly enhanced in the presence of heparin. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product