SERPINE1 antibody (70R-5413)

Rabbit polyclonal SERPINE1 antibody raised against the N terminal of SERPINE1

Synonyms Polyclonal SERPINE1 antibody, Anti-SERPINE1 antibody, Serpin Peptidase Inhibitor Clade E Member 1 antibody, SERPINE 1, PLANH1 antibody, SERPINE-1, SERPINE-1 antibody, PAI antibody, PAI-1 antibody, SERPINE1, SERPINE 1 antibody, PAI1 antibody
Specificity SERPINE1 antibody was raised against the N terminal of SERPINE1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen SERPINE1 antibody was raised using the N terminal of SERPINE1 corresponding to a region with amino acids VAHLASDFGVRVFQQVAQASKDRNVVFSPYGVASVLAMLQLTTGGETQQQ
Assay Information SERPINE1 Blocking Peptide, catalog no. 33R-9417, is also available for use as a blocking control in assays to test for specificity of this SERPINE1 antibody


Western Blot analysis using SERPINE1 antibody (70R-5413)

SERPINE1 antibody (70R-5413) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 43 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SERPINE1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SERPINE1 acts as 'bait' for tissue plasminogen activator, urokinase, and protein C. Its rapid interaction with TPA may function as a major control point in the regulation of fibrinolysis.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using SERPINE1 antibody (70R-5413) | SERPINE1 antibody (70R-5413) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors