SERPINF2 Blocking Peptide (33R-1815)

A synthetic peptide for use as a blocking control in assays to test for specificity of SERPINF2 antibody, catalog no. 70R-9700

Synonyms SERPINF2 control peptide, SERPINF2 antibody Blocking Peptide, Anti-SERPINF2 Blocking Peptide, serpin peptidase inhibitor, clade F, alpha-2 antiplasmin, pigment epithelium derived factor, member 2 Blocking Peptide, A2AP Blocking Peptide, AAP Blocking Peptide, ALPHA-2-PI Blocking Peptide, API Blocking Peptide, PLI Blocking Peptide, SERPINF2, SERPINF-2, SERPINF 2, SERPINF-2 Blocking Peptide, SERPINF 2 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues CSRDPTPEQTHRLARAMMAFTADLFSLVAQTSTCPNLILSPLSVALALSH
Molecular Weight 54 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a member of the serpin family of serine protease inhibitors. The protein is a major inhibitor of plasmin, which degrades fibrin and various other proteins. Consequently, the proper function of this gene has a major role in regulating the blood clotting pathway. Mutations in this gene result in alpha-2-plasmin inhibitor deficiency, which is characterized by severe hemorrhagic diathesis.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors