SERPINF2 Blocking Peptide (33R-1815)
A synthetic peptide for use as a blocking control in assays to test for specificity of SERPINF2 antibody, catalog no. 70R-9700
Overview
Overview
| Synonyms | SERPINF2 control peptide, SERPINF2 antibody Blocking Peptide, Anti-SERPINF2 Blocking Peptide, serpin peptidase inhibitor, clade F, alpha-2 antiplasmin, pigment epithelium derived factor, member 2 Blocking Peptide, A2AP Blocking Peptide, AAP Blocking Peptide, ALPHA-2-PI Blocking Peptide, API Blocking Peptide, PLI Blocking Peptide, SERPINF2, SERPINF-2, SERPINF 2, SERPINF-2 Blocking Peptide, SERPINF 2 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | CSRDPTPEQTHRLARAMMAFTADLFSLVAQTSTCPNLILSPLSVALALSH |
|---|---|
| Molecular Weight | 54 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | This gene encodes a member of the serpin family of serine protease inhibitors. The protein is a major inhibitor of plasmin, which degrades fibrin and various other proteins. Consequently, the proper function of this gene has a major role in regulating the blood clotting pathway. Mutations in this gene result in alpha-2-plasmin inhibitor deficiency, which is characterized by severe hemorrhagic diathesis. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product