SERPINI1 antibody (70R-5263)

Rabbit polyclonal SERPINI1 antibody

Synonyms Polyclonal SERPINI1 antibody, Anti-SERPINI1 antibody, Serpin Peptidase Inhibitor Clade I Member 1 antibody, Neuroserpin 1 antibody, SERPINI-1, neuroserpin antibody, SERPINI 1 antibody, PI12 antibody, SERPINI1, DKFZp781N13156 antibody, SERPINI 1, SERPINI-1 antibody
Cross Reactivity Human, Mouse, Rat
Applications WB
Immunogen SERPINI1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ALINAVYFKGNWKSQFRPENTRTFSFTKDDESEVQIPMMYQQGEFYYGEF
Assay Information SERPINI1 Blocking Peptide, catalog no. 33R-1340, is also available for use as a blocking control in assays to test for specificity of this SERPINI1 antibody

Images

Western Blot analysis using SERPINI1 antibody (70R-5263)

SERPINI1 antibody (70R-5263) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 46 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SERPINI1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a member of the serpin superfamily of serine proteinase inhibitors. The protein is primarily secreted by axons in the brain, and preferentially reacts with and inhibits tissue-type plasminogen activator.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SERPINI1 antibody (70R-5263) | SERPINI1 antibody (70R-5263) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €309.90
Size: 50 ug
OR
Shipping
View Our Distributors