SERPINI2 antibody (70R-5480)

Rabbit polyclonal SERPINI2 antibody

Synonyms Polyclonal SERPINI2 antibody, Anti-SERPINI2 antibody, SERPINI2, Pancpin 2 antibody, SERPINI-2 antibody, SERPINI 2 antibody, PI14 antibody, SERPINI-2, TSA2004 antibody, Serpin Peptidase Inhibitor Clade I Member 2 antibody, SERPINI 2, PANCPIN antibody, MEPI antibody
Cross Reactivity Human, Mouse
Applications WB
Immunogen SERPINI2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LPRFKVEQKVDFKDVLYSLNITEIFSGGCDLSGITDSSEVYVSQVTQKVF
Assay Information SERPINI2 Blocking Peptide, catalog no. 33R-5285, is also available for use as a blocking control in assays to test for specificity of this SERPINI2 antibody


Western Blot analysis using SERPINI2 antibody (70R-5480)

SERPINI2 antibody (70R-5480) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 46 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SERPINI2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene is a member of the serine protease inhibitor (serpin) superfamily made up of proteins which play central roles in the regulation of a wide variety of physiological processes, including coagulation and fibrinolysis.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using SERPINI2 antibody (70R-5480) | SERPINI2 antibody (70R-5480) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors