SET antibody (70R-5618)

Rabbit polyclonal SET antibody raised against the N terminal of SET

Synonyms Polyclonal SET antibody, Anti-SET antibody, PHAPII antibody, 2PP2A antibody, TAF-IBETA antibody, I2PP2A antibody, Set Nuclear Oncogene antibody, IGAAD antibody
Specificity SET antibody was raised against the N terminal of SET
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen SET antibody was raised using the N terminal of SET corresponding to a region with amino acids IDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVT
Assay Information SET Blocking Peptide, catalog no. 33R-3911, is also available for use as a blocking control in assays to test for specificity of this SET antibody


Western Blot analysis using SET antibody (70R-5618)

SET antibody (70R-5618) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 32 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SET antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SET is a multitasking protein, involved in apoptosis, transcription, nucleosome assembly and histone binding. Isoform 2 anti-apoptotic activity is mediated by inhibition of the GZMA-activated DNase, NME1.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using SET antibody (70R-5618) | SET antibody (70R-5618) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors