SF1 antibody (70R-1476)

Rabbit polyclonal SF1 antibody raised against the N terminal of SF1

Synonyms Polyclonal SF1 antibody, Anti-SF1 antibody, SF-1, SF-1 antibody, Splicing Factor 1 antibody, SF 1, SF1, SF 1 antibody
Specificity SF1 antibody was raised against the N terminal of SF1
Cross Reactivity Human, Mouse, Dog
Applications IHC, WB
Immunogen SF1 antibody was raised using the N terminal of SF1 corresponding to a region with amino acids NATPLDFPSKKRKRSRWNQDTMEQKTVIPGMPTVIPPGLTREQERAYIVQ
Assay Information SF1 Blocking Peptide, catalog no. 33R-6645, is also available for use as a blocking control in assays to test for specificity of this SF1 antibody


Western blot analysis using SF1 antibody (70R-1476)

Recommended SF1 Antibody Titration: 1.25ug/ml


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 68 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of SF1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SF1 contains 1 KH domain and 1 CCHC-type zinc finger. It is necessary for the ATP-dependent first step of spliceosome assembly and binds to the intron branch point sequence (BPS) 5'-UACUAAC-3' of the pre-mRNA. It may act as transcription repressor.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western blot analysis using SF1 antibody (70R-1476) | Recommended SF1 Antibody Titration: 1.25ug/ml
  • Immunohistochemical staining using SF1 antibody (70R-1476) | Human Heart
  • Immunohistochemical staining using SF1 antibody (70R-1476) | Human Kidney

Availability: In stock

Price: €227.26
Size: 100 ug
View Our Distributors