SF1 antibody (70R-4988)

Rabbit polyclonal SF1 antibody raised against the C terminal of SF1

Synonyms Polyclonal SF1 antibody, Anti-SF1 antibody, SF1, ZFM1 antibody, ZNF162 antibody, SF-1 antibody, D11S636 antibody, SF 1 antibody, Splicing Factor 1 antibody, SF-1, SF 1
Specificity SF1 antibody was raised against the C terminal of SF1
Cross Reactivity Human
Applications WB
Immunogen SF1 antibody was raised using the C terminal of SF1 corresponding to a region with amino acids APPPPPPPPPGSAGMMIPPRGGDGPSHESEDFPRPLVTLPGRQPQQRPWW
Assay Information SF1 Blocking Peptide, catalog no. 33R-1432, is also available for use as a blocking control in assays to test for specificity of this SF1 antibody

Images

Western blot analysis using SF1 antibody (70R-4988)

Recommended SF1 Antibody Titration: 0.2-1 ug/ml

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 69 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SF1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SF1 contains 1 CCHC-type zinc finger and 1 KH domain. SF1 is Necessary for the ATP-dependent first step of spliceosome assembly. It binds to the intron branch point sequence (BPS) 5'-UACUAAC-3' of the pre-mRNA. SF1 may act as transcription repressor.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western blot analysis using SF1 antibody (70R-4988) | Recommended SF1 Antibody Titration: 0.2-1 ug/ml

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors