SF3A1 Blocking Peptide (33R-8124)
A synthetic peptide for use as a blocking control in assays to test for specificity of SF3A1 antibody, catalog no. 70R-4828
Overview
Overview
| Synonyms | SF3A1 control peptide, SF3A1 antibody Blocking Peptide, Anti-SF3A1 Blocking Peptide, Splicing Factor 3A Subunit 1 120Kda Blocking Peptide, PRP21 Blocking Peptide, PRPF21 Blocking Peptide, SAP114 Blocking Peptide, SF3A120 Blocking Peptide, SF3A1, SFA1-3, SFA1 3, SFA1-3 Blocking Peptide, SFA1 3 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | RQNEINNPKFNFLNPNDPYHAYYRHKVSEFKEGKAQEPSAAIPKVMQQQQ |
|---|---|
| Molecular Weight | 89 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | SF3A1 is the subunit 1 of the splicing factor 3a protein complex. The splicing factor 3a heterotrimer includes subunits 1, 2 and 3 and is necessary for the in vitro conversion of 15S U2 snRNP into an active 17S particle that performs pre-mRNA splicing. Subunit 1 belongs to the SURP protein family; named for the SURP motifs that are thought to mediate RNA binding. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product