SF3A1 Blocking Peptide (33R-8124)

A synthetic peptide for use as a blocking control in assays to test for specificity of SF3A1 antibody, catalog no. 70R-4828

Synonyms SF3A1 control peptide, SF3A1 antibody Blocking Peptide, Anti-SF3A1 Blocking Peptide, Splicing Factor 3A Subunit 1 120Kda Blocking Peptide, PRP21 Blocking Peptide, PRPF21 Blocking Peptide, SAP114 Blocking Peptide, SF3A120 Blocking Peptide, SF3A1, SFA1-3, SFA1 3, SFA1-3 Blocking Peptide, SFA1 3 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues RQNEINNPKFNFLNPNDPYHAYYRHKVSEFKEGKAQEPSAAIPKVMQQQQ
Molecular Weight 89 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SF3A1 is the subunit 1 of the splicing factor 3a protein complex. The splicing factor 3a heterotrimer includes subunits 1, 2 and 3 and is necessary for the in vitro conversion of 15S U2 snRNP into an active 17S particle that performs pre-mRNA splicing. Subunit 1 belongs to the SURP protein family; named for the SURP motifs that are thought to mediate RNA binding.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors