SF3B1 antibody (70R-1332)

Rabbit polyclonal SF3B1 antibody raised against the middle region of SF3B1

Synonyms Polyclonal SF3B1 antibody, Anti-SF3B1 antibody, SFB1-3, Splicing Factor 3B Subunit 1 155Kda antibody, SF3B1, SFB1 3, SFB1 3 antibody, SFB1-3 antibody
Specificity SF3B1 antibody was raised against the middle region of SF3B1
Cross Reactivity Human,Mouse,Rat,Dog
Applications IHC, WB
Immunogen SF3B1 antibody was raised using the middle region of SF3B1 corresponding to a region with amino acids LLNDIPQSTEQYDPFAEHRPPKIADREDEYKKHRRTMIISPERLDPFADG
Assay Information SF3B1 Blocking Peptide, catalog no. 33R-5171, is also available for use as a blocking control in assays to test for specificity of this SF3B1 antibody


Immunohistochemical staining using SF3B1 antibody (70R-1332)

SF3B1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Hepatocytes (arrows) in Human Liver. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 87 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of SF3B1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SF3B1 is the subunit 1 of the splicing factor 3b protein complex. Splicing factor 3b, together with splicing factor 3a and a 12S RNA unit, forms the U2 small nuclear ribonucleoproteins complex (U2 snRNP). The splicing factor 3b/3a complex binds pre-mRNA upstream of the intron's branch site in a sequence independent manner and may anchor the U2 snRNP to the pre-mRNA. Splicing factor 3b is also a component of the minor U12-type spliceosome.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using SF3B1 antibody (70R-1332) | SF3B1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Hepatocytes (arrows) in Human Liver. Magnification is at 400X
  • Western Blot analysis using SF3B1 antibody (70R-1332) | SF3B1 antibody (70R-1332) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: €227.26
Size: 100 ug
View Our Distributors