SF3B1 antibody (70R-1333)

Rabbit polyclonal SF3B1 antibody raised against the N terminal of SF3B1

Synonyms Polyclonal SF3B1 antibody, Anti-SF3B1 antibody, SFB1-3, SFB1 3 antibody, SF3b155 antibody, Splicing Factor 3B Subunit 1 155Kda antibody, PRP10 antibody, SF3B1, SAP155 antibody, SFB1 3, SFB1-3 antibody
Specificity SF3B1 antibody was raised against the N terminal of SF3B1
Cross Reactivity Human,Mouse,Rat,Dog
Applications IHC, WB
Immunogen SF3B1 antibody was raised using the N terminal of SF3B1 corresponding to a region with amino acids MAKIAKTHEDIEAQIREIQGKKAALDEAQGVGLDSTGYYDQEIYGGSDSR
Assay Information SF3B1 Blocking Peptide, catalog no. 33R-5678, is also available for use as a blocking control in assays to test for specificity of this SF3B1 antibody

Images

Immunohistochemical staining using SF3B1 antibody (70R-1333)

SF3B1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Hepatocytes (arrows) in Human Liver. Magnification is at 400X.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 143 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of SF3B1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SF3B1 is the subunit 1 of the splicing factor 3b protein complex. Splicing factor 3b, together with splicing factor 3a and a 12S RNA unit, forms the U2 small nuclear ribonucleoproteins complex (U2 snRNP). The splicing factor 3b/3a complex binds pre-mRNA upstream of the intron's branch site in a sequence independent manner and may anchor the U2 snRNP to the pre-mRNA. Splicing factor 3b is also a component of the minor U12-type spliceosome.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using SF3B1 antibody (70R-1333) | SF3B1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Hepatocytes (arrows) in Human Liver. Magnification is at 400X.
  • Western Blot analysis using SF3B1 antibody (70R-1333) | SF3B1 antibody (70R-1333) used at 1.25 ug/ml to detect target protein.
  • Immunohistochemical staining using SF3B1 antibody (70R-1333) | SF3B1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epidermal cells (arrows) in Human Skin. Magnification is at 400X

Availability: In stock

Price: €296.37
Size: 100 ug
OR
Shipping
View Our Distributors