SF3B1 antibody (70R-1366)

Rabbit polyclonal SF3B1 antibody raised against the N terminal of SF3B1

Synonyms Polyclonal SF3B1 antibody, Anti-SF3B1 antibody, SFB1 3 antibody, SFB1-3 antibody, SFB1 3, SFB1-3, Splicing Factor 3B Subunit 1 155Kda antibody, SF3B1
Specificity SF3B1 antibody was raised against the N terminal of SF3B1
Cross Reactivity Human,Mouse,Rat,Dog
Applications WB
Immunogen SF3B1 antibody was raised using the N terminal of SF3B1 corresponding to a region with amino acids ERLDPFADGGKTPDPKMNARTYMDVMREQHLTKEEREIRQQLAEKAKAGE
Assay Information SF3B1 Blocking Peptide, catalog no. 33R-2699, is also available for use as a blocking control in assays to test for specificity of this SF3B1 antibody


Western Blot analysis using SF3B1 antibody (70R-1366)

SF3B1 antibody (70R-1366) used at 0.3125 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 87 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of SF3B1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.3125 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SF3B1 is subunit 1 of the splicing factor 3b protein complex. Splicing factor 3b, together with splicing factor 3a and a 12S RNA unit, forms the U2 small nuclear ribonucleoproteins complex (U2 snRNP). The splicing factor 3b/3a complex binds pre-mRNA upstream of the intron's branch site in a sequence independent manner and may anchor the U2 snRNP to the pre-mRNA. Splicing factor 3b is also a component of the minor U12-type spliceosome. The carboxy-terminal two-thirds of subunit 1 have 22 non-identical, tandem HEAT repeats that form rod-like, helical structures.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using SF3B1 antibody (70R-1366) | SF3B1 antibody (70R-1366) used at 0.3125 ug/ml to detect target protein.

Availability: In stock

Price: €258.73
Size: 100 ug
View Our Distributors