SF4 antibody (70R-4979)

Rabbit polyclonal SF4 antibody raised against the middle region of SF4

Synonyms Polyclonal SF4 antibody, Anti-SF4 antibody, DKFZp434E2216 antibody, SF 4, SF 4 antibody, RBP antibody, SF-4, SF-4 antibody, F23858 antibody, SF4, Splicing Factor 4 antibody
Specificity SF4 antibody was raised against the middle region of SF4
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen SF4 antibody was raised using the middle region of SF4 corresponding to a region with amino acids TFKALKEGREPDYSEYKEFKLTVENIGYQMLMKMGWKEGEGLGSEGQGIK
Assay Information SF4 Blocking Peptide, catalog no. 33R-9065, is also available for use as a blocking control in assays to test for specificity of this SF4 antibody

Images

Western Blot analysis using SF4 antibody (70R-4979)

SF4 antibody (70R-4979) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 72 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SF4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SF4 is a member of the SURP family of splicing factors. SF4 is a member of the SURP family of splicing factors.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SF4 antibody (70R-4979) | SF4 antibody (70R-4979) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors