SFRS10 antibody (70R-1421)

Rabbit polyclonal SFRS10 antibody

Synonyms Polyclonal SFRS10 antibody, Anti-SFRS10 antibody, SFRS10, Transformer 2 Homolog Drosophila antibody, SFRS-10 antibody, SFRS 10, Splicing Factor Arginine/Serine-Rich 10 antibody, SFRS 10 antibody, SFRS-10
Cross Reactivity Human, Mouse, Rat, Dog
Applications IHC, WB
Immunogen SFRS10 antibody was raised using a synthetic peptide corresponding to a region with amino acids GVFGLSLYTTERDLREVFSKYGPIADVSIVYDQQSRRSRGFAFVYFENVD
Assay Information SFRS10 Blocking Peptide, catalog no. 33R-3636, is also available for use as a blocking control in assays to test for specificity of this SFRS10 antibody


Immunohistochemical staining using SFRS10 antibody (70R-1421)

SFRS10 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Skeletal muscle cells (arrows) in Human Muscle. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 32 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of SFRS10 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SFRS10 contains 1 RRM (RNA recognition motif) domain and belongs to the splicing factor SR family. It is a sequence-specific RNA-binding protein which participates in the control of pre-mRNA splicing.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using SFRS10 antibody (70R-1421) | SFRS10 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Skeletal muscle cells (arrows) in Human Muscle. Magnification is at 400X
  • Western Blot analysis using SFRS10 antibody (70R-1421) | SFRS10 antibody (70R-1421) used at 5 ug/ml to detect target protein.

Availability: In stock

Price: €258.73
Size: 100 ug
View Our Distributors