SFRS11 antibody (70R-4779)

Rabbit polyclonal SFRS11 antibody raised against the C terminal of SFRS11

Synonyms Polyclonal SFRS11 antibody, Anti-SFRS11 antibody, Splicing Factor Arginine/Serine-Rich 11 antibody, DKFZp686M13204 antibody, SFRS 11 antibody, SFRS 11, SFRS11, SFRS-11 antibody, dJ677H15.2 antibody, p54 antibody, SFRS-11
Specificity SFRS11 antibody was raised against the C terminal of SFRS11
Cross Reactivity Human
Applications WB
Immunogen SFRS11 antibody was raised using the C terminal of SFRS11 corresponding to a region with amino acids KKKSKDKEKDRERKSESDKDVKQVTRDYDEEEQGYDSEKEKKEEKKPIET
Assay Information SFRS11 Blocking Peptide, catalog no. 33R-4478, is also available for use as a blocking control in assays to test for specificity of this SFRS11 antibody

Images

Western blot analysis using SFRS11 antibody (70R-4779)

Recommended SFRS11 Antibody Titration: 0.2-1 ug/ml

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 53 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SFRS11 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SFRS11 is 54 kDa nuclear protein that contains an arginine/serine-rich region similar to segments found in pre-mRNA splicing factors. Although the function of this protein is not yet known, structure and immunolocalization data suggest that it may play a role in pre-mRNA processing.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western blot analysis using SFRS11 antibody (70R-4779) | Recommended SFRS11 Antibody Titration: 0.2-1 ug/ml

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors