SFTPB antibody (70R-5411)

Rabbit polyclonal SFTPB antibody raised against the middle region of SFTPB

Synonyms Polyclonal SFTPB antibody, Anti-SFTPB antibody, SFTP3 antibody, SP-B antibody, Surfactant Pulmonary-Associated Protein B antibody, SMDP1 antibody, PSP-B antibody, SFTB3 antibody
Specificity SFTPB antibody was raised against the middle region of SFTPB
Cross Reactivity Human,Rat
Applications WB
Immunogen SFTPB antibody was raised using the middle region of SFTPB corresponding to a region with amino acids PGALQARPGPHTQDLSEQQFPIPLPYCWLCRALIKRIQAMIPKGALAVAV
Assay Information SFTPB Blocking Peptide, catalog no. 33R-7093, is also available for use as a blocking control in assays to test for specificity of this SFTPB antibody

Images

Western Blot analysis using SFTPB antibody (70R-5411)

SFTPB antibody (70R-5411) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 42 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SFTPB antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SFTPB is the pulmonary-associated surfactant B protein (SPB), an amphipathic surfactant protein essential for lung function and homeostasis after birth. Pulmonary surfactant is a lipid-rich material that prevents lung collapse by lowering surface tension at the air-liquid interface in the alveoli of lung. SPB enhances the rate of spreading and increases the stability of surfactant monolayers in vitro. Surfactant is composed of phospholipids and other surfactant-associated proteins.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SFTPB antibody (70R-5411) | SFTPB antibody (70R-5411) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors