SFTPD Blocking Peptide (33R-7253)
A synthetic peptide for use as a blocking control in assays to test for specificity of SFTPD antibody, catalog no. 70R-5911
Overview
Overview
| Synonyms | SFTPD control peptide, SFTPD antibody Blocking Peptide, Anti-SFTPD Blocking Peptide, Surfactant Pulmonary-Associated Protein D Blocking Peptide, COLEC7 Blocking Peptide, PSP-D Blocking Peptide, SFTP4 Blocking Peptide, SP-D Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | PPGPPGVPGPAGREGPLGKQGNIGPQGKPGPKGEAGPKGEVGAPGMQGSA |
|---|---|
| Molecular Weight | 35 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | SFTPD contributes to the lung's defense against inhaled microorganisms. SFTPD may participate in the extracellular reorganization or turnover of pulmonary surfactant. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product