SGK1 Blocking Peptide (33R-1406)

A synthetic peptide for use as a blocking control in assays to test for specificity of SGK1 antibody, catalog no. 70R-6014

Synonyms SGK1 control peptide, SGK1 antibody Blocking Peptide, Anti-SGK1 Blocking Peptide, Serum/Glucocorticoid Regulated Kinase 1 Blocking Peptide, SGK Blocking Peptide, SGK1, SGK-1, SGK 1, SGK-1 Blocking Peptide, SGK 1 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues ANPSPPPSPSQQINLGPSSNPHAKPSDFHFLKVIGKGSFGKVLLARHKAE
Molecular Weight 49 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a serine/threonine protein kinase that plays an important role in cellular stress response. This kinase activates certain potassium, sodium, and chloride channels.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors