SGK1 Blocking Peptide (33R-1406)
A synthetic peptide for use as a blocking control in assays to test for specificity of SGK1 antibody, catalog no. 70R-6014
Overview
Overview
| Synonyms | SGK1 control peptide, SGK1 antibody Blocking Peptide, Anti-SGK1 Blocking Peptide, Serum/Glucocorticoid Regulated Kinase 1 Blocking Peptide, SGK Blocking Peptide, SGK1, SGK-1, SGK 1, SGK-1 Blocking Peptide, SGK 1 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | ANPSPPPSPSQQINLGPSSNPHAKPSDFHFLKVIGKGSFGKVLLARHKAE |
|---|---|
| Molecular Weight | 49 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | This gene encodes a serine/threonine protein kinase that plays an important role in cellular stress response. This kinase activates certain potassium, sodium, and chloride channels. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product