SGK3 antibody (70R-5846)

Rabbit polyclonal SGK3 antibody raised against the N terminal of SGK3

Synonyms Polyclonal SGK3 antibody, Anti-SGK3 antibody, CISK antibody, SGK-3 antibody, SGKL antibody, SGK-3, SGK3, SGK 3 antibody, Serum/Glucocorticoid Regulated Kinase Family Member 3 antibody, DKFZp781N0293 antibody, SGK 3, SGK2 antibody
Specificity SGK3 antibody was raised against the N terminal of SGK3
Cross Reactivity Human
Applications WB
Immunogen SGK3 antibody was raised using the N terminal of SGK3 corresponding to a region with amino acids LYNHPDVRAFLQMDSPKHQSDPSEDEDERSSQKLHSTSQNINLGPSGNPH
Assay Information SGK3 Blocking Peptide, catalog no. 33R-5569, is also available for use as a blocking control in assays to test for specificity of this SGK3 antibody

Images

Immunohistochemical staining using SGK3 antibody (70R-5846)

SGK3 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 53 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SGK3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene is a member of the Ser/Thr protein kinase family and encodes a phosphoprotein with a PX (phox homology) domain. The protein phosphorylates several target proteins and has a role in neutral amino acid transport and activation of potassium and chloride channels. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using SGK3 antibody (70R-5846) | SGK3 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using SGK3 antibody (70R-5846) | SGK3 antibody (70R-5846) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors