SH2D3C antibody (70R-5771)

Rabbit polyclonal SH2D3C antibody raised against the N terminal of SH2D3C

Synonyms Polyclonal SH2D3C antibody, Anti-SH2D3C antibody, Sh2 Domain Containing 3C antibody, FLJ39664 antibody, NSP3 antibody, SHD3C 2 antibody, CHAT antibody, PRO34088 antibody, SHD3C 2, SHD3C-2, SHD3C-2 antibody, SH2D3C
Specificity SH2D3C antibody was raised against the N terminal of SH2D3C
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen SH2D3C antibody was raised using the N terminal of SH2D3C corresponding to a region with amino acids AGSDYVKFSKEKYILDSSPEKLHKELEEELKLSSTDLRSHAWYHGRIPRE
Assay Information SH2D3C Blocking Peptide, catalog no. 33R-1220, is also available for use as a blocking control in assays to test for specificity of this SH2D3C antibody

Images

Western Blot analysis using SH2D3C antibody (70R-5771)

SH2D3C antibody (70R-5771) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 77 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SH2D3C antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SH2D3C is an Eph receptor-binding protein which may be a positive regulator of TCR signaling. Binding to BCAR1 of SH2D3C is required to induce membrane ruffling and promote EGF-dependent cell migration.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SH2D3C antibody (70R-5771) | SH2D3C antibody (70R-5771) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors