SH2D3C Blocking Peptide (33R-1220)

A synthetic peptide for use as a blocking control in assays to test for specificity of SH2D3C antibody, catalog no. 70R-5771

Synonyms SH2D3C control peptide, SH2D3C antibody Blocking Peptide, Anti-SH2D3C Blocking Peptide, Sh2 Domain Containing 3C Blocking Peptide, CHAT Blocking Peptide, FLJ39664 Blocking Peptide, NSP3 Blocking Peptide, PRO34088 Blocking Peptide, SH2D3C, SHD3C-2, SHD3C 2, SHD3C-2 Blocking Peptide, SHD3C 2 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues AGSDYVKFSKEKYILDSSPEKLHKELEEELKLSSTDLRSHAWYHGRIPRE
Molecular Weight 77 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SH2D3C is an Eph receptor-binding protein which may be a positive regulator of TCR signaling. Binding to BCAR1 of SH2D3C is required to induce membrane ruffling and promote EGF-dependent cell migration.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors