SH2D3C Blocking Peptide (33R-1220)
A synthetic peptide for use as a blocking control in assays to test for specificity of SH2D3C antibody, catalog no. 70R-5771
Overview
Overview
| Synonyms | SH2D3C control peptide, SH2D3C antibody Blocking Peptide, Anti-SH2D3C Blocking Peptide, Sh2 Domain Containing 3C Blocking Peptide, CHAT Blocking Peptide, FLJ39664 Blocking Peptide, NSP3 Blocking Peptide, PRO34088 Blocking Peptide, SH2D3C, SHD3C-2, SHD3C 2, SHD3C-2 Blocking Peptide, SHD3C 2 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | AGSDYVKFSKEKYILDSSPEKLHKELEEELKLSSTDLRSHAWYHGRIPRE |
|---|---|
| Molecular Weight | 77 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | SH2D3C is an Eph receptor-binding protein which may be a positive regulator of TCR signaling. Binding to BCAR1 of SH2D3C is required to induce membrane ruffling and promote EGF-dependent cell migration. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product