SH3BGRL antibody (70R-3848)

Rabbit polyclonal SH3BGRL antibody raised against the middle region of SH3BGRL

Synonyms Polyclonal SH3BGRL antibody, Anti-SH3BGRL antibody, MGC117402 antibody, SH3BGRL, SH3BGR antibody, SHBGRL-3, SHBGRL 3, SHBGRL 3 antibody, Sh3 Domain Binding Glutamic Acid-Rich Protein Like antibody, SHBGRL-3 antibody
Specificity SH3BGRL antibody was raised against the middle region of SH3BGRL
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen SH3BGRL antibody was raised using the middle region of SH3BGRL corresponding to a region with amino acids PQIFNESQYRGDYDAFFEARENNAVYAFLGLTAPPGSKEAEVQAKQQA
Assay Information SH3BGRL Blocking Peptide, catalog no. 33R-7300, is also available for use as a blocking control in assays to test for specificity of this SH3BGRL antibody

Images

Western Blot analysis using SH3BGRL antibody (70R-3848)

SH3BGRL antibody (70R-3848) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 13 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SH3BGRL antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SH3BGRL belongs to the SH3BGR family. Mutations in predicted EVH1-binding domain of SH3BGRL had a modest effect on suppression of v-Rel transformation.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SH3BGRL antibody (70R-3848) | SH3BGRL antibody (70R-3848) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors