SIGLEC6 Blocking Peptide (33R-9741)

A synthetic peptide for use as a blocking control in assays to test for specificity of SIGLEC6 antibody, catalog no. 70R-6173

Synonyms SIGLEC6 control peptide, SIGLEC6 antibody Blocking Peptide, Anti-SIGLEC6 Blocking Peptide, Sialic Acid Binding Ig-Like Lectin 6 Blocking Peptide, CD33L Blocking Peptide, CD33L1 Blocking Peptide, CDw327 Blocking Peptide, OBBP1 Blocking Peptide, SIGLEC-6 Blocking Peptide, SIGLEC6, SIGLEC-6, SIGLEC 6, SIGLEC-6 Blocking Peptide, SIGLEC 6 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues VPVATNDPDEEVQEETRGRFHLLWDPRRKNCSLSIRDARRRDNAAYFFRL
Molecular Weight 47 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SIGLEC6 is a Putative adhesion molecule that mediates sialic-acid dependent binding to cells. It binds to alpha-2,6-linked sialic acid. The sialic acid recognition site may be masked by cis interactions with sialic acids on the same cell surface.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors