SIGLEC6 Blocking Peptide (33R-9741)
A synthetic peptide for use as a blocking control in assays to test for specificity of SIGLEC6 antibody, catalog no. 70R-6173
Overview
Overview
| Synonyms | SIGLEC6 control peptide, SIGLEC6 antibody Blocking Peptide, Anti-SIGLEC6 Blocking Peptide, Sialic Acid Binding Ig-Like Lectin 6 Blocking Peptide, CD33L Blocking Peptide, CD33L1 Blocking Peptide, CDw327 Blocking Peptide, OBBP1 Blocking Peptide, SIGLEC-6 Blocking Peptide, SIGLEC6, SIGLEC-6, SIGLEC 6, SIGLEC-6 Blocking Peptide, SIGLEC 6 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | VPVATNDPDEEVQEETRGRFHLLWDPRRKNCSLSIRDARRRDNAAYFFRL |
|---|---|
| Molecular Weight | 47 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | SIGLEC6 is a Putative adhesion molecule that mediates sialic-acid dependent binding to cells. It binds to alpha-2,6-linked sialic acid. The sialic acid recognition site may be masked by cis interactions with sialic acids on the same cell surface. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product