SIGLEC7 Blocking Peptide (33R-10031)

A synthetic peptide for use as a blocking control in assays to test for specificity of SIGLEC7 antibody, catalog no. 70R-6142

Synonyms SIGLEC7 control peptide, SIGLEC7 antibody Blocking Peptide, Anti-SIGLEC7 Blocking Peptide, Sialic Acid Binding Ig-Like Lectin 7 Blocking Peptide, AIRM1 Blocking Peptide, CDw328 Blocking Peptide, D-siglec Blocking Peptide, QA79 Blocking Peptide, SIGLEC-7 Blocking Peptide, p75 Blocking Peptide, p75/AIRM1 Blocking Peptide, SIGLEC7, SIGLEC-7, SIGLEC 7, SIGLEC-7 Blocking Peptide, SIGLEC 7 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues WTWRSLTLYPSQPSNPLVLELQVHLGDEGEFTCRAQNSLGSQHVSLNLSL
Molecular Weight 51 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SIGLEC7 is a putative adhesion molecule that mediates sialic-acid dependent binding to cells. In the immune response, it may act as an inhibitory receptor upon ligand induced tyrosine phosphorylation by recruiting cytoplasmic phosphatase(s) via their SH2 domain(s) that block signal transduction through dephosphorylation of signaling molecules.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors