SIGLEC7 Blocking Peptide (33R-10031)
A synthetic peptide for use as a blocking control in assays to test for specificity of SIGLEC7 antibody, catalog no. 70R-6142
Overview
Overview
| Synonyms | SIGLEC7 control peptide, SIGLEC7 antibody Blocking Peptide, Anti-SIGLEC7 Blocking Peptide, Sialic Acid Binding Ig-Like Lectin 7 Blocking Peptide, AIRM1 Blocking Peptide, CDw328 Blocking Peptide, D-siglec Blocking Peptide, QA79 Blocking Peptide, SIGLEC-7 Blocking Peptide, p75 Blocking Peptide, p75/AIRM1 Blocking Peptide, SIGLEC7, SIGLEC-7, SIGLEC 7, SIGLEC-7 Blocking Peptide, SIGLEC 7 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | WTWRSLTLYPSQPSNPLVLELQVHLGDEGEFTCRAQNSLGSQHVSLNLSL |
|---|---|
| Molecular Weight | 51 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | SIGLEC7 is a putative adhesion molecule that mediates sialic-acid dependent binding to cells. In the immune response, it may act as an inhibitory receptor upon ligand induced tyrosine phosphorylation by recruiting cytoplasmic phosphatase(s) via their SH2 domain(s) that block signal transduction through dephosphorylation of signaling molecules. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product