SIP1 antibody (70R-4677)

Rabbit polyclonal SIP1 antibody raised against the middle region of SIP1

Synonyms Polyclonal SIP1 antibody, Anti-SIP1 antibody, SIP-1 antibody, SIP1-delta antibody, SIP1, Survival Of Motor Neuron Protein Interacting Protein 1 antibody, GEMIN2 antibody, SIP 1, SIP-1, SIP 1 antibody
Specificity SIP1 antibody was raised against the middle region of SIP1
Cross Reactivity Human
Applications WB
Immunogen SIP1 antibody was raised using the middle region of SIP1 corresponding to a region with amino acids HSLIRQLARRCSEVRLLVDSKDDERVPALNLLICLVSRYFDQRDLADEPS
Assay Information SIP1 Blocking Peptide, catalog no. 33R-3856, is also available for use as a blocking control in assays to test for specificity of this SIP1 antibody


Western Blot analysis using SIP1 antibody (70R-4677)

SIP1 antibody (70R-4677) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 30 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SIP1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Part of the core SMN complex which plays an essential role in spliceosomal snRNP assembly in the cytoplasm and is required for pre-mRNA splicing in the nucleus.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using SIP1 antibody (70R-4677) | SIP1 antibody (70R-4677) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors