SIRT4 Blocking Peptide (33R-7782)
A synthetic peptide for use as a blocking control in assays to test for specificity of SIRT4 antibody, catalog no. 70R-7923
Overview
Overview
| Synonyms | SIRT4 control peptide, SIRT4 antibody Blocking Peptide, Anti-SIRT4 Blocking Peptide, sirtuin, silent mating type information regulation 2 homolog 4, S. cerevisiae Blocking Peptide, MGC130046 Blocking Peptide, MGC130047 Blocking Peptide, MGC57437 Blocking Peptide, SIR2L4 Blocking Peptide, sirtuin 4 Blocking Peptide, SIRT4, SIRT-4, SIRT 4, SIRT-4 Blocking Peptide, SIRT 4 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | QVPTCVQCGGHLKPDVVFFGDTVNPDKVDFVHKRVKEADSLLVVGSSLQV |
|---|---|
| Molecular Weight | 35 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | SIRT4 is a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been determined; however, yeast sirtuin proteins are known to regulate epigenetic gene silencing and suppress recombination of rDNA. Studies suggest that the human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity. SIRT4 is included in class IV of the sirtuin family. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product