SKA3 antibody (70R-3270)

Rabbit polyclonal SKA3 antibody raised against the middle region of SKA3

Synonyms Polyclonal SKA3 antibody, Anti-SKA3 antibody, SKA3, SKA-3, RAMA1 antibody, MGC4832 antibody, SKA-3 antibody, SKA 3 antibody, Spindle And Kinetochore Associated Complex Subunit 3 antibody, SKA 3
Specificity SKA3 antibody was raised against the middle region of SKA3
Cross Reactivity Human
Applications WB
Immunogen SKA3 antibody was raised using the middle region of SKA3 corresponding to a region with amino acids EVEDRTSLVLNSDTCFENLTDPSSPTISSYENLLRTPTPPEVTKIPEDIL
Assay Information SKA3 Blocking Peptide, catalog no. 33R-2779, is also available for use as a blocking control in assays to test for specificity of this SKA3 antibody


Western Blot analysis using SKA3 antibody (70R-3270)

SKA3 antibody (70R-3270) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 46 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SKA3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This protein is a component of the spindle and kinetochore-associated protein complex that regulates microtubule attachment to the kinetochores during mitosis. The encoded protein localizes to the outer kinetechore and may be required for normal chromosome segregation and cell division. Alternative splicing results in multiple transcript variants.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using SKA3 antibody (70R-3270) | SKA3 antibody (70R-3270) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors