SKIV2L antibody (70R-4624)

Rabbit polyclonal SKIV2L antibody

Synonyms Polyclonal SKIV2L antibody, Anti-SKIV2L antibody, HLP antibody, SKIVL-2 antibody, SKIV2L, SKIV2 antibody, SKIVL 2, Superkiller Viralicidic Activity 2-Like antibody, SKI2W antibody, SKIVL 2 antibody, SKI2 antibody, DDX13 antibody, 170A antibody, SKIVL-2
Cross Reactivity Human
Applications WB
Immunogen SKIV2L antibody was raised using a synthetic peptide corresponding to a region with amino acids SSNSTSRVFTTLVLCDKPLSQDPQDRGPATAEVPYPDDLVGFKLFLPEGP
Assay Information SKIV2L Blocking Peptide, catalog no. 33R-8835, is also available for use as a blocking control in assays to test for specificity of this SKIV2L antibody

Images

Western Blot analysis using SKIV2L antibody (70R-4624)

SKIV2L antibody (70R-4624) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 138 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SKIV2L antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SKIV2L antibody (70R-4624) | SKIV2L antibody (70R-4624) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors