SLA1 antibody (70R-2081)

Rabbit polyclonal SLA1 antibody raised against the middle region of SLA

Synonyms Polyclonal SLA1 antibody, Anti-SLA1 antibody, SLA-1 antibody, SLA antibody, SLAP antibody, SLA 1 antibody, SLA-1, Src-Like-Adaptor antibody, SLA1, SLA 1
Specificity SLA1 antibody was raised against the middle region of SLA
Cross Reactivity Human
Applications WB
Immunogen SLA1 antibody was raised using the middle region of SLA corresponding to a region with amino acids PEGTENPLGVDESLFSYGLRESIASYLSLTSEDNTSFDRKKKSISLMYGG
Assay Information SLA1 Blocking Peptide, catalog no. 33R-7045, is also available for use as a blocking control in assays to test for specificity of this SLA1 antibody


Western Blot analysis using SLA1 antibody (70R-2081)

SLA1 antibody (70R-2081) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 31 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLA antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SLA is an adapter protein, which negatively regulates T-cell receptor (TCR) signaling. SLA inhibits T-cell antigen-receptor induced activation of nuclear factor of activated T-cells.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using SLA1 antibody (70R-2081) | SLA1 antibody (70R-2081) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
View Our Distributors