SLAIN1 antibody (70R-3394)

Rabbit polyclonal SLAIN1 antibody raised against the middle region of SLAIN1

Synonyms Polyclonal SLAIN1 antibody, Anti-SLAIN1 antibody, SLAIN-1, C13orf32 antibody, SLAIN1, SLAIN 1 antibody, SLAIN 1, Slain Motif Family Member 1 antibody, FLJ30046 antibody, SLAIN-1 antibody, MGC131899 antibody
Specificity SLAIN1 antibody was raised against the middle region of SLAIN1
Cross Reactivity Human,Rat
Applications WB
Immunogen SLAIN1 antibody was raised using the middle region of SLAIN1 corresponding to a region with amino acids RSPSSQYFPSNNYQQQQYYSPQAQTPDQQPNRTNGDKLRRSMPNLARMPS
Assay Information SLAIN1 Blocking Peptide, catalog no. 33R-8203, is also available for use as a blocking control in assays to test for specificity of this SLAIN1 antibody

Images

Western Blot analysis using SLAIN1 antibody (70R-3394)

SLAIN1 antibody (70R-3394) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 38 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLAIN1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of SLAIN1 protein has not been widely studied, and is yet to be fully elucidated.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SLAIN1 antibody (70R-3394) | SLAIN1 antibody (70R-3394) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors