SLC12A2 antibody (70R-1731)

Rabbit polyclonal SLC12A2 antibody

Synonyms Polyclonal SLC12A2 antibody, Anti-SLC12A2 antibody, SLC12A2, NKCC1 antibody, SLCA2-12, SLCA2 12 antibody, BSC2 antibody, SLCA2 12, Sodium/Potassium/Chloride Transporters 2 antibody, SLCA2-12 antibody, Solute Carrier Family 12 Sodium/Potassium/Chloride Transporters Member 2 antibody, MGC104233 antibody, BSC antibody
Cross Reactivity Human,Mouse,Rat,Dog
Applications WB
Immunogen SLC12A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids IIAFEEIIEPYRLHEDDKEQDIADKMKEDEPWRITDNELELYKTKTYRQI
Assay Information SLC12A2 Blocking Peptide, catalog no. 33R-3991, is also available for use as a blocking control in assays to test for specificity of this SLC12A2 antibody


Western Blot analysis using SLC12A2 antibody (70R-1731)

Western Blot showing SLC12A2 antibody used at a concentration of 1-2 ug/ml to detect its target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 131 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of SLC12A2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance By moving chloride into epithelial cells, the Na-K-Cl cotransporter SLC12A2 aids transcellular movement of chloride across both secretory and absorptive epithelia.By moving chloride into epithelial cells, the Na-K-Cl cotransporter SLC12A2 aids transcellular movement of chloride across both secretory and absorptive epithelia.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using SLC12A2 antibody (70R-1731) | Western Blot showing SLC12A2 antibody used at a concentration of 1-2 ug/ml to detect its target protein.

Availability: In stock

Price: €258.73
Size: 100 ug
View Our Distributors