SLC13A3 antibody (70R-1822)

Rabbit polyclonal SLC13A3 antibody

Synonyms Polyclonal SLC13A3 antibody, Anti-SLC13A3 antibody, SLCA3-13 antibody, SLCA3 13, Sodium-Dependent Dicarboxylate Transporter 3 antibody, SLCA3 13 antibody, NADC3 antibody, SLCA3-13, Solute Carrier Family 13 Sodium-dependent Dicarboxylate Transporter Member 3 antibody, SLC13A3, SDCT2 antibody
Cross Reactivity Human
Applications IHC, WB
Immunogen SLC13A3 antibody was raised using a synthetic peptide corresponding to a region with amino acids GLSFRGWRKNKSEIRTNAEDRARAVIREEYQNLGPIKFAEQAVFILFCMF
Assay Information SLC13A3 Blocking Peptide, catalog no. 33R-3423, is also available for use as a blocking control in assays to test for specificity of this SLC13A3 antibody


Immunohistochemical staining using SLC13A3 antibody (70R-1822)

SLC13A3 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 61 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of SLC13A3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Mammalian sodium-dicarboxylate cotransporters transport succinate and other Krebs cycle intermediates. They fall into 2 categories based on their substrate affinity: low affinity and high affinity. Both the low- and high-affinity transporters play an important role in the handling of citrate by the kidneys. SLC13A3 represents the high-affinity form.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using SLC13A3 antibody (70R-1822) | SLC13A3 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X
  • Western Blot analysis using SLC13A3 antibody (70R-1822) | SLC13A3 antibody (70R-1822) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: €227.26
Size: 100 ug
View Our Distributors