SLC22A2 antibody (70R-1735)

Rabbit polyclonal SLC22A2 antibody

Synonyms Polyclonal SLC22A2 antibody, Anti-SLC22A2 antibody, OCT2 antibody, Organic Cation Transporter 2 antibody, Solute Carrier Family 22 Member 2 antibody, SLCA2-22, MGC32628 antibody, SLC22A2, SLCA2-22 antibody, SLCA2 22, SLCA2 22 antibody
Cross Reactivity Human
Applications WB
Immunogen SLC22A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MPTTVDDVLEHGGEFHFFQKQMFFLLALLSATFAPIYVGIVFLGFTPDHR
Assay Information SLC22A2 Blocking Peptide, catalog no. 33R-6311, is also available for use as a blocking control in assays to test for specificity of this SLC22A2 antibody


Western Blot analysis using SLC22A2 antibody (70R-1735)

SLC22A2 antibody (70R-1735) used at 2.5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 62 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of SLC22A2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Polyspecific organic cation transporters in the liver, kidney, intestine, and other organs are critical for elimination of many endogenous small organic cations as well as a wide array of drugs and environmental toxins. SLC22A2 is one of the three similar cation transporters. SLC22A2 contains twelve putative transmembrane domains and is a plasma integral membrane protein. It is found primarily in the kidney, where it may mediate the first step in cation reabsorption.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using SLC22A2 antibody (70R-1735) | SLC22A2 antibody (70R-1735) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: €258.73
Size: 100 ug
View Our Distributors