SLC25A36 antibody (70R-6399)

Rabbit polyclonal SLC25A36 antibody raised against the N terminal of SLC25A36

Synonyms Polyclonal SLC25A36 antibody, Anti-SLC25A36 antibody, SLCA36-25 antibody, SLC25A36, SLCA36 25, Solute Carrier Family 25 Member 36 antibody, SLCA36 25 antibody, FLJ10618 antibody, DKFZp564C053 antibody, SLCA36-25
Specificity SLC25A36 antibody was raised against the N terminal of SLC25A36
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen SLC25A36 antibody was raised using the N terminal of SLC25A36 corresponding to a region with amino acids SSSVTLYISEVQLNTMAGASVNRVVSPGPLHCLKVILEKEGPRSLFRGLG
Assay Information SLC25A36 Blocking Peptide, catalog no. 33R-8854, is also available for use as a blocking control in assays to test for specificity of this SLC25A36 antibody


Western Blot analysis using SLC25A36 antibody (70R-6399)

SLC25A36 antibody (70R-6399) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 34 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLC25A36 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SLC25A36 belongs to the mitochondrial carrier family. It contains 3 Solcar repeats. SLC25A36 is a multi-pass membrane protein. The function of the SLC25A36 protein remains unknown.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using SLC25A36 antibody (70R-6399) | SLC25A36 antibody (70R-6399) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors