SLC26A8 antibody (70R-1764)

Rabbit polyclonal SLC26A8 antibody raised against the C terminal of SLC26A8

Synonyms Polyclonal SLC26A8 antibody, Anti-SLC26A8 antibody, RP11-482O9.1 antibody, SLCA8-26, SLCA8 26 antibody, SLCA8-26 antibody, SLC26A8, Solute Carrier Family 26 Member 8 antibody, TAT1 antibody, SLCA8 26, FLJ32714 antibody
Specificity SLC26A8 antibody was raised against the C terminal of SLC26A8
Cross Reactivity Human
Applications IHC, WB
Immunogen SLC26A8 antibody was raised using the C terminal of SLC26A8 corresponding to a region with amino acids EPQPETEPEMEPNPKSRPRAHTFPQQRYWPMYHPSMASTQSQTQTRTWSV
Assay Information SLC26A8 Blocking Peptide, catalog no. 33R-2643, is also available for use as a blocking control in assays to test for specificity of this SLC26A8 antibody


Immunohistochemical staining using SLC26A8 antibody (70R-1764)

SLC26A8 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Neural cells (arrows) in Human Brain. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 61 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of SLC26A8 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SLC26A8 is one member of a family of sulfate/anion transporters. Family members are well conserved in their protein (aa length among species) structures yet have markedly different tissue expression patterns.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using SLC26A8 antibody (70R-1764) | SLC26A8 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Neural cells (arrows) in Human Brain. Magnification is at 400X
  • Western Blot analysis using SLC26A8 antibody (70R-1764) | SLC26A8 antibody (70R-1764) used at 5 ug/ml to detect target protein.

Availability: In stock

Price: €227.26
Size: 100 ug
View Our Distributors