GAP43 Blocking Peptide (33R-1006)
A synthetic peptide for use as a blocking control in assays to test for specificity of SLC35E2 antibody, catalog no. 70R-6754
Overview
Overview
| Synonyms | SLC35E2 control peptide, SLC35E2 antibody Blocking Peptide, Anti-SLC35E2 Blocking Peptide, Solute Carrier Family 35 Member E2 Blocking Peptide, DKFZp686M0869 Blocking Peptide, FLJ34996 Blocking Peptide, FLJ44537 Blocking Peptide, KIAA0447 Blocking Peptide, MGC104754 Blocking Peptide, MGC117254 Blocking Peptide, MGC126715 Blocking Peptide, MGC138494 Blocking Peptide, SLC35E2, SLC-35E2, SLC 35E3, SLC35-E3, SLC35 E3, SLC-35E2 protein, SLC 35E3 protein, SLC35-E3 protein, SLC35 E3 protein |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | AAASDRRSPVPPSERHGVRPHGENLPGDFQVPQALHRVALSMALPCPMLP |
|---|---|
| Molecular Weight | 29 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | SLC35E2 is a putative transporter. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product