SLC35F5 antibody (70R-1798)

Rabbit polyclonal SLC35F5 antibody raised against the C terminal of SLC35F5

Synonyms Polyclonal SLC35F5 antibody, Anti-SLC35F5 antibody, SLCF5 35, SLCF5-35, FLJ22004 antibody, SLC35F5, SLCF5 35 antibody, Solute Carrier Family 35 Member F5 antibody, SLCF5-35 antibody
Specificity SLC35F5 antibody was raised against the C terminal of SLC35F5
Cross Reactivity Human, Mouse, Rat
Applications WB
Immunogen SLC35F5 antibody was raised using the C terminal of SLC35F5 corresponding to a region with amino acids VDREDKLDIPMFFGFVGLFNLLLLWPGFFLLHYTGFEDFEFPNKVVLMCI
Assay Information SLC35F5 Blocking Peptide, catalog no. 33R-9476, is also available for use as a blocking control in assays to test for specificity of this SLC35F5 antibody

Images

Western Blot analysis using SLC35F5 antibody (70R-1798)

SLC35F5 antibody (70R-1798) used at 2.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 59 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of SLC35F5 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SLC35F5 is a putative solute transporter.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SLC35F5 antibody (70R-1798) | SLC35F5 antibody (70R-1798) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: €258.73
Size: 100 ug
OR
Shipping
View Our Distributors