SLC36A3 antibody (70R-1801)

Rabbit polyclonal SLC36A3 antibody

Synonyms Polyclonal SLC36A3 antibody, Anti-SLC36A3 antibody, tramdorin2 antibody, SLCA3-36, SLCA3-36 antibody, TRAMD2 antibody, SLCA3 36, PAT3 antibody, SLC36A3, Solute Carrier Family 36 Member 3 antibody, Proton/Amino Acid Symporter 3 antibody, SLCA3 36 antibody
Cross Reactivity Human
Applications IHC, WB
Immunogen SLC36A3 antibody was raised using a synthetic peptide corresponding to a region with amino acids MSLLGRDYNSELNSLDNGPQSPSESSSSITSENVHPAGEAGLSMMQTLIH
Assay Information SLC36A3 Blocking Peptide, catalog no. 33R-6462, is also available for use as a blocking control in assays to test for specificity of this SLC36A3 antibody


Immunohistochemical staining using SLC36A3 antibody (70R-1801)

SLC36A3 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 52 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of SLC36A3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of SLC36A3 protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using SLC36A3 antibody (70R-1801) | SLC36A3 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X
  • Western Blot analysis using SLC36A3 antibody (70R-1801) | SLC36A3 antibody (70R-1801) used at 5 ug/ml to detect target protein.

Availability: In stock

Price: €227.26
Size: 100 ug
View Our Distributors