SLC38A4 antibody (70R-1214)

Rabbit polyclonal SLC38A4 antibody raised against the middle region of SLC38A4

Synonyms Polyclonal SLC38A4 antibody, Anti-SLC38A4 antibody, Solute Carrier Family 38 Member 4 antibody, SLCA4 38, SLCA4-38, SLCA4 38 antibody, SLCA4-38 antibody, FLJ10191 antibody, NAT3 antibody, ATA3 antibody, PAAT antibody, MGC126876 antibody, SLC38A4
Specificity SLC38A4 antibody was raised against the middle region of SLC38A4
Cross Reactivity Human, Mouse, Rat, Dog, C.elegans, Drosophila, ZebraFish
Applications IHC, WB
Immunogen SLC38A4 antibody was raised using the middle region of SLC38A4 corresponding to a region with amino acids LAALFGYLTFYGEVEDELLHAYSKVYTLDIPLLMVRLAVLVAVTLTVPIV
Assay Information SLC38A4 Blocking Peptide, catalog no. 33R-4755, is also available for use as a blocking control in assays to test for specificity of this SLC38A4 antibody


Immunohistochemical staining using SLC38A4 antibody (70R-1214)

SLC38A4 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 17 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of SLC38A4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SLC38A4 is found predominantly in liver and transports both cationic and neutral amino acids. The transport of cationic amino acids by SLC38A4 is Na(+) and pH independent, while the transport of neutral amino acids is Na(+) and pH dependent.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using SLC38A4 antibody (70R-1214) | SLC38A4 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X
  • Western Blot analysis using SLC38A4 antibody (70R-1214) | SLC38A4 antibody (70R-1214) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: €227.26
Size: 100 ug
View Our Distributors